Anti-RDH8 (aa 111-160) polyclonal antibody

Name Anti-RDH8 (aa 111-160) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-25362
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within internal sequence amino acids 111-160 (FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASK F) of Human RDH8 (NP_056540).
Description Rabbit Polyclonal
Gene RDH8
Conjugate Unconjugated
Supplier Page Shop