Anti-RNF113A (aa 53-102) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-12707
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide within Human RNF113A aa 53-102 (N terminal). The exact sequence is proprietary.Sequence: VVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKS Database link: O15541 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: RNF113A
• Conjugate: Unconjugated