Anti-RPL23AP82 (aa 2-51) polyclonal antibody

Name Anti-RPL23AP82 (aa 2-51) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-19405
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N terminal amino acids 2-51 (SLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE E) of Human MGC70863 (NP_976047)
Description Rabbit Polyclonal
Gene RPL23AP82
Conjugate Unconjugated
Supplier Page Shop