Anti-SEP15 (aa 109-158) polyclonal antibody

Name Anti-SEP15 (aa 109-158) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-18094
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen A synthetic peptide within residues VRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEF corresponding to amino acids 109-158 of Human SEP15 (NP_004252)
Description Rabbit Polyclonal
Gene SEP15
Conjugate Unconjugated
Supplier Page Shop