Anti-SIAH3 (aa 46-95) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-12518
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide within Human SIAH3 aa 46-95 (N terminal). The exact sequence is proprietary.Sequence: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA Database link: Q8IW03 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: SIAH3
• Conjugate: Unconjugated