Anti-SLC30A7 (aa 200-250) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-13714
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC-P WB IHC-F
• Species Reactivities: Human
• Antigen: Synthetic peptide corresponding to Human SLC30A7 aa 200-250. Immunogen was conjugated to an immunogenic carrier proteinSequence: HGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSI G Database link: Q8NEW0
• Description: Rabbit Polyclonal
• Gene: SLC30A7
• Conjugate: Unconjugated