Rabbit anti-Human SLC7A9 polyclonal antibody

Name Rabbit anti-Human SLC7A9 polyclonal antibody
Supplier Creative Diagnostics
Catalog DPAB-DC365
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P
Species Reactivities Human
Antigen Recombinant protein corresponding to amino acids of human SLC7A9. The sequence is YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
Purity/Format Antigen affinity purification
Description Rabbit Polyclonal
Gene SLC7A9
Conjugate Unconjugated
Supplier Page Shop