Name | Rabbit anti-Human SLC7A9 polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | DPAB-DC365 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P |
Species Reactivities | Human |
Antigen | Recombinant protein corresponding to amino acids of human SLC7A9. The sequence is YKFGWAQKISKPITMHLQMLMEVVPPEEDPE |
Purity/Format | Antigen affinity purification |
Description | Rabbit Polyclonal |
Gene | SLC7A9 |
Conjugate | Unconjugated |
Supplier Page | Shop |