Anti-SPACA4 (aa 39-88) polyclonal antibody

Name Anti-SPACA4 (aa 39-88) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-22225
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N terminal amino acids 39-88 (MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLT T) of Human SPACA4 (NP_598005)
Description Rabbit Polyclonal
Gene SPACA4
Conjugate Unconjugated
Supplier Page Shop