Anti-SPAG7 (aa 16-65) polyclonal antibody

Name Anti-SPAG7 (aa 16-65) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-26864
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N terminal amino acids 16-65 (PSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSG Q) of Human SPAG7 (NM_004890).
Description Rabbit Polyclonal
Gene SPAG7
Conjugate Unconjugated
Supplier Page Shop