Rabbit anti-Human Syntabulin polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-15095
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC-P IHC-F
• Species Reactivities: Human
• Antigen: Synthetic peptide within Human Syntabulin aa 5-50. The exact sequence is proprietary. Conjugated to an immunogenic carrier protein.Sequence: RESKKEHRVQHHDKEISRSRIPRLILRPHMPQQQHKVSPASESPFS Database link: Q9NX95
• Purity/Format: Whole antiserum
• Description: Rabbit Polyclonal
• Gene: SYBU
• Conjugate: Unconjugated