Anti-TAF7L (aa 415-464) polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-27764
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Mouse
• Antigen: Synthetic peptide within Mouse TAF7L aa 415-464 (C terminal). The exact sequence is proprietary.Sequence: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ Database link: Q9D3R9 Run BLAST with Run BLAST with
• Description: Rabbit Polyclonal
• Gene: Taf7l
• Conjugate: Unconjugated