Anti-TMEM208 (aa 144-173) polyclonal antibody

Name Anti-TMEM208 (aa 144-173) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-24527
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC-P
Species Reactivities Human
Antigen Recombinant fragment: PWFTADSGTPAPEHNEKRQRRQERRQMKRL, corresponding to amino acids 144-173 of Human TMEM208 Isoform 1 (Q9BTX3).
Description Rabbit Polyclonal
Gene TMEM208
Conjugate Unconjugated
Supplier Page Shop