Anti-TMEM263 (aa 8-37) polyclonal antibody

Name Anti-TMEM263 (aa 8-37) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-21079
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P ICC/IF
Species Reactivities Human
Antigen antigen sequence: QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR, corresponding to N terminal amino acids 8-37 of Human C12orf23.
Description Rabbit Polyclonal
Gene TMEM263
Conjugate Unconjugated
Supplier Page Shop