| Name | Anti-WDR59 (aa 605-654) polyclonal antibody |
|---|---|
| Supplier | Creative Diagnostics |
| Catalog | DPABH-13234 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide within Human WDR59 aa 605-654 (C terminal). The exact sequence is proprietary.Sequence: TRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIAC Database link: Q6PJI9 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | WDR59 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |