Anti-YIF1A (aa 240-269) polyclonal antibody

Name Anti-YIF1A (aa 240-269) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-17940
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P WB ICC/IF
Species Reactivities Mouse, Rat, Human
Antigen antigen sequence corresponding to amino acids 240-269 (ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ) of Human YIF1A.
Description Rabbit Polyclonal
Gene YIF1A
Conjugate Unconjugated
Supplier Page Shop