| Name | Anti-ZFP92 (aa 51-80) polyclonal antibody |
|---|---|
| Supplier | Creative Diagnostics |
| Catalog | DPABH-13420 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide within Human ZFP92 aa 51-80 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.Sequence: VSLGFSFSKPHLISQLERGEGPWVADIPRT Database link: A6NM28 |
| Description | Rabbit Polyclonal |
| Gene | ZFP92 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |