Name | Anti-ZNF641 (aa 388-437) polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | DPABH-18681 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 388-437 (RHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSV F) of Human ZNF641, NP_689533 |
Description | Rabbit Polyclonal |
Gene | ZNF641 |
Conjugate | Unconjugated |
Supplier Page | Shop |