| Name | Anti-Sp5 Picoband™ Antibody PB9443 |
|---|---|
| Supplier | Boster Bio |
| Catalog | PB9443 |
| Prices | $240.00 |
| Sizes | 1 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC-P WB |
| Antigen | A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence. |
| Purity/Format | Immunogen affinity purified. |
| Description | Rabbit Polyclonal |
| Gene | SP5 |
| Supplier Page | Shop |