Name | Osteocalcin Antibody | AbD02591 |
---|---|
Supplier | AbD Serotec |
Catalog | HCA029 |
Prices | $135.00 |
Sizes | 50 µg |
Host | Human |
Clonality | Monoclonal |
Isotype | HuCAL Fab bivalent |
Clone | AbD02591 |
Applications | ELISA WB |
Species Reactivities | Bovine |
Antigen | Native bovine Osteocalcin with the sequence YLDHWLGAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV |
Purity/Format | A bivalent human recombinant Fab selected from the HuCAL® GOLD phage display library. Expressed in E. coli and purified using NiNTA affinity chromatography. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a his-tag (HHHHHH) at the C-terminus of the anti-body heavy chain. - Lyophilised |
Description | Human Monoclonal |
Gene | BGLAP |
Supplier Page | Shop |
Delmas PD, Stenner DD, Romberg RW, Riggs BL, Mann KG. Biochemistry. 1984 Sep 25;23(20):4720-5.
Lee AJ, Hodges S, Eastell R. Ann Clin Biochem. 2000 Jul;37 ( Pt 4):432-46.