Name | C14ORF44 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4163 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | C14ORF44 antibody was raised using the middle region of C14Orf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ |
Purity/Format | Affinity purified |
Description | Rabbit polyclonal C14ORF44 antibody raised against the middle region of C14Orf44 |
Gene | FAM161B |
Supplier Page | Shop |