ADARB2, Polyclonal Antibody

Name ADARB2, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300659
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
Purity/Format Affinity purified
Description ADARB2 antibody
Gene ADARB2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.