BXDC5, Polyclonal Antibody

Name BXDC5, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300972
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD
Purity/Format Affinity purified
Description BXDC5 antibody
Gene RPF1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.