Name | C10ORF83, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5300155 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | C10ORF83 antibody was raised using the middle region of C10Orf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA |
Purity/Format | Affinity purified |
Description | C10ORF83 antibody |
Gene | MORN4 |
Supplier Page | Shop |