| Name | C10ORF83, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300155 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C10ORF83 antibody was raised using the middle region of C10Orf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA |
| Purity/Format | Affinity purified |
| Description | C10ORF83 antibody |
| Gene | MORN4 |
| Supplier Page | Shop |