| Name | C13ORF28, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302511 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C13ORF28 antibody was raised using the middle region of C13Orf28 corresponding to a region with amino acids PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ |
| Purity/Format | Affinity purified |
| Description | C13ORF28 antibody |
| Gene | SPACA7 |
| Supplier Page | Shop |