| Name | C15ORF26, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302058 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C15ORF26 antibody was raised using the C terminal Of C15Orf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV |
| Purity/Format | Affinity purified |
| Description | C15ORF26 antibody |
| Gene | C15orf26 |
| Supplier Page | Shop |