| Name | C16ORF58, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303238 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C16ORF58 antibody was raised using the N terminal Of C16Orf58 corresponding to a region with amino acids QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN |
| Purity/Format | Affinity purified |
| Description | C16ORF58 antibody |
| Gene | C16orf58 |
| Supplier Page | Shop |