| Name | C17ORF64, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839859 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C17ORF64 antibody was raised using the middle region of C17Orf64 corresponding to a region with amino acids NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE |
| Purity/Format | Affinity purified |
| Description | C17ORF64 antibody |
| Gene | C17orf64 |
| Supplier Page | Shop |