| Name | C17ORF71, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303062 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C17ORF71 antibody was raised using the middle region of C17Orf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF |
| Purity/Format | Affinity purified |
| Description | C17ORF71 antibody |
| Gene | SMG8 |
| Supplier Page | Shop |