C18orf56, Polyclonal Antibody

Name C18orf56, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839944
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C18orf56 antibody was raised using the N terminal of C18orf56 corresponding to a region with amino acids MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV
Purity/Format Affinity purified
Description C18orf56 antibody
Gene TYMSOS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.