Name | C18orf56, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839944 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C18orf56 antibody was raised using the N terminal of C18orf56 corresponding to a region with amino acids MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV |
Purity/Format | Affinity purified |
Description | C18orf56 antibody |
Gene | TYMSOS |
Supplier Page | Shop |