| Name | C19ORF56, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302280 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C19ORF56 antibody was raised using the N terminal Of C19Orf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML |
| Purity/Format | Affinity purified |
| Description | C19ORF56 antibody |
| Gene | WDR83OS |
| Supplier Page | Shop |