| Name | C1ORF142, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS838889 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C1ORF142 antibody was raised using the middle region of C1Orf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA |
| Purity/Format | Affinity purified |
| Description | C1ORF142 antibody |
| Gene | SNAP47 |
| Supplier Page | Shop |