| Name | C3ORF62, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302749 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C3ORF62 antibody was raised using the middle region of C3Orf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA |
| Purity/Format | Affinity purified |
| Description | C3ORF62 antibody |
| Gene | C3orf62 |
| Supplier Page | Shop |