Name | C4ORF23, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5300985 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | C4ORF23 antibody was raised using the N terminal Of C4Orf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK |
Purity/Format | Affinity purified |
Description | C4ORF23 antibody |
Gene | TRMT44 |
Supplier Page | Shop |