| Name | C4ORF23, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300985 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | C4ORF23 antibody was raised using the N terminal Of C4Orf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK |
| Purity/Format | Affinity purified |
| Description | C4ORF23 antibody |
| Gene | TRMT44 |
| Supplier Page | Shop |