| Name | C4ORF28, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300208 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C4ORF28 antibody was raised using the middle region of C4Orf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL |
| Purity/Format | Affinity purified |
| Description | C4ORF28 antibody |
| Gene | PACRGL |
| Supplier Page | Shop |