| Name | C6ORF146, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300135 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C6ORF146 antibody was raised using the middle region of C6Orf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP |
| Purity/Format | Affinity purified |
| Description | C6ORF146 antibody |
| Gene | FAM217A |
| Supplier Page | Shop |