| Name | C7ORF29, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302701 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C7ORF29 antibody was raised using the middle region of C7Orf29 corresponding to a region with amino acids VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH |
| Purity/Format | Affinity purified |
| Description | C7ORF29 antibody |
| Gene | ZBED6CL |
| Supplier Page | Shop |