| Name | CCDC74A, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302505 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CCDC74A antibody was raised using the middle region of CCDC74A corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL |
| Purity/Format | Affinity purified |
| Description | CCDC74A antibody |
| Gene | CCDC74A |
| Supplier Page | Shop |