| Name | CCDC76, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300811 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE |
| Purity/Format | Affinity purified |
| Description | CCDC76 antibody |
| Gene | TRMT13 |
| Supplier Page | Shop |