CHIC1, Polyclonal Antibody

Name CHIC1, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300485
Prices $370.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog, Zebrafish
Antigen CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV
Purity/Format Total IgG Protein A purified
Description CHIC1 antibody
Gene CHIC1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.