COQ2, Polyclonal Antibody

Name COQ2, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5301938
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Purity/Format Affinity purified
Description COQ2 antibody
Gene COQ2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.