| Name | Cryptochrome 2, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303191 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE |
| Purity/Format | Affinity purified |
| Description | Cryptochrome 2 antibody |
| Gene | CRY2 |
| Supplier Page | Shop |