| Name | D15WSU75E, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS838970 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | D15WSU75E antibody was raised using the middle region of D15Wsu75E corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ |
| Purity/Format | Affinity purified |
| Description | D15WSU75E antibody |
| Gene | DESI1 |
| Supplier Page | Shop |