DHX35, Polyclonal Antibody

Name DHX35, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5302883
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ
Purity/Format Affinity purified
Description DHX35 antibody
Gene DHX35
Supplier Page Shop