| Name | FAM118A, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301326 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM118A antibody was raised using the middle region of FAM118A corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL |
| Purity/Format | Affinity purified |
| Description | FAM118A antibody |
| Gene | FAM118A |
| Supplier Page | Shop |