Name | FAM131C, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839456 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM131C antibody was raised using the middle region of FAM131C corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF |
Purity/Format | Affinity purified |
Description | FAM131C antibody |
Gene | FAM131C |
Supplier Page | Shop |