| Name | FAM134A, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839837 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM134A antibody was raised using the N terminal of FAM134A corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS |
| Purity/Format | Affinity purified |
| Description | FAM134A antibody |
| Gene | FAM134A |
| Supplier Page | Shop |