| Name | FAM19A4, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301579 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM19A4 antibody was raised using the middle region of FAM19A4 corresponding to a region with amino acids SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVA |
| Purity/Format | Affinity purified |
| Description | FAM19A4 antibody |
| Gene | FAM19A4 |
| Supplier Page | Shop |