Name | FAM71D, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5302278 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM71D antibody was raised using the middle region of FAM71D corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN |
Purity/Format | Affinity purified |
Description | FAM71D antibody |
Gene | FAM71D |
Supplier Page | Shop |