| Name | FAM71D, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302278 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM71D antibody was raised using the middle region of FAM71D corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN |
| Purity/Format | Affinity purified |
| Description | FAM71D antibody |
| Gene | FAM71D |
| Supplier Page | Shop |