| Name | FAM79B, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS838881 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM79B antibody was raised using the N terminal Of Fam79B corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH |
| Purity/Format | Affinity purified |
| Description | FAM79B antibody |
| Gene | TPRG1 |
| Supplier Page | Shop |