| Name | FAM81B, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301776 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM81B antibody was raised using the N terminal of FAM81B corresponding to a region with amino acids MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS |
| Purity/Format | Affinity purified |
| Description | FAM81B antibody |
| Gene | FAM81B |
| Supplier Page | Shop |